PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010102208.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 441aa    MW: 49020.8 Da    PI: 5.8252
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010102208.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32219273155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWt+eLHe+Fveav++LGGse+AtPk i++lmkv++Lt++hvkSHLQkYR+
  XP_010102208.1 219 KPRMRWTQELHEAFVEAVNKLGGSERATPKGIVNLMKVPSLTIYHVKSHLQKYRT 273
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.341216276IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-30217275IPR009057Homeodomain-like
SuperFamilySSF466894.3E-18217273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24219273IPR006447Myb domain, plants
PfamPF002491.0E-8221272IPR001005SANT/Myb domain
PfamPF143791.5E-19304350IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MSLSFPVGST SLEDKYSKLP DTFSVSSQRK MMFNPSTRQA SPLGSSAGSS GHLFSSPSPF  60
PNDVPISYVP HHERHPHNSP VIPESSGGKS LPPIHSSLSE VQSTALNDHI GENKDVSWCP  120
DAFQDFLDFP EMESVQNDQV ERSTIPLTSE DHGEKTDWSA WDQLITIGDD LDQYWPDLPG  180
NCNATDSKQE QSQNYQHQPS QSGEHSTVSD PSSAAPSTKP RMRWTQELHE AFVEAVNKLG  240
GSERATPKGI VNLMKVPSLT IYHVKSHLQK YRTARYKPEP AEGNSEKQST SSEDVETKEV  300
KTSMGITEAL RLQVELQKRL HEQLENQRKL QLQIEEQGKY LQKMFEQHKK MENKLKASPS  360
TSNDPCSPLS NIVNHSGESN KSKNSEQDHP RTGISPSNSE LDGSSNDASR KRKAQETEFD  420
KAPDSSNVEP DVPPTKYARS G
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102208.10.0Myb family transcription factor APL
TrEMBLW9RHI80.0W9RHI8_9R
STRINGVIT_14s0036g01380.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.25e-78G2-like family protein